PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00001.1.g09160.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 231aa    MW: 23756.7 Da    PI: 10.2468
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00001.1.g09160.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP67.33.1e-21185231248
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 
                                   Cq+++C a+l++ak+yh+rhkvCe+h+ka vv+v+g++qrfCqqCsr
  Zjn_sc00001.1.g09160.1.am.mk 185 CQADRCGANLADAKRYHKRHKVCETHAKAHVVIVAGRQQRFCQQCSR 231
                                   **********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-22178231IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.478182231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.89E-20183231IPR004333Transcription factor, SBP-box
PfamPF031103.0E-16185231IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MWFLYTYSRT AYAHAPRHGT GPHVRAVSTH VARWQDLFIP LSPFFPTAPA SSRPPSAHEH  60
ELKATAAPAP PRQPAGSYPP SPSTAPPPPP NLATMDRRDR TRRATSAAAS MAALAAAAAA  120
GEGAENGTAT AMAEDMNTPM LLTGAASGVS LTPTAAVPVS ARNGPAAAAG AVEAGAGGGG  180
GGPSCQADRC GANLADAKRY HKRHKVCETH AKAHVVIVAG RQQRFCQQCS R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-18175231157squamosa promoter binding protein-like 4
1wj0_A3e-18180231152squamosa promoter-binding protein-like 12
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFP0966263e-33FP096626.1 Phyllostachys edulis cDNA clone: bphylf027p18, full insert sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6077822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.22e-17squamosa promoter binding protein-like 8